PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G3011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 277aa    MW: 31769.2 Da    PI: 6.8086
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G3011genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.53.5e-092671346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                      WT eE +++  a + +G +   +W ++a++++ g+t  +++  ++ 
      Gh_A05G3011 26 YWTREENKRFESALAIYGEDvpdRWMKVAAMIP-GKTVSDVIKQYRE 71
                     5********************************.*******999986 PP

2Myb_DNA-binding40.27.7e-13125169347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ +  ++G+g+W+ I+r +   +t+ q+ s+ qky
      Gh_A05G3011 125 PWTEEEHRRFLMGLMKYGKGDWRNISRNFVISKTPTQVASHAQKY 169
                      8*****************************789***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.6932277IPR017884SANT domain
SMARTSM007179.7E-82375IPR001005SANT/Myb domain
SuperFamilySSF466894.21E-122581IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-42572IPR009057Homeodomain-like
PfamPF002499.2E-82771IPR001005SANT/Myb domain
CDDcd001671.05E-72772No hitNo description
Gene3DG3DSA:1.10.10.601.0E-11117175IPR009057Homeodomain-like
PROSITE profilePS5129419.794118174IPR017930Myb domain
SuperFamilySSF466891.1E-15120173IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-18121173IPR006447Myb domain, plants
SMARTSM007171.8E-11122172IPR001005SANT/Myb domain
CDDcd001672.01E-9125170No hitNo description
PfamPF002495.2E-11125169IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
METFFATSFM SNSDWFDQED ISRNPYWTRE ENKRFESALA IYGEDVPDRW MKVAAMIPGK  60
TVSDVIKQYR ELEEDVFDIE SGRIPIPGYL TSSFTFEMVD NHDFEPYRKR SNAKGPDHER  120
KKGVPWTEEE HRRFLMGLMK YGKGDWRNIS RNFVISKTPT QVASHAQKYF QRQLSGGKDK  180
KRPSIHDITT LSITTPNTGF SDNQSGHVLA LHQKLSSTLQ KVDHNNDASA MALNSSQEDW  240
FTSSQQYLTA SNGLRFDGQN LYGNGFHGAQ PPQSSVF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-1527921176RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.249580.0boll
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5850425e-63JX585042.1 Gossypium hirsutum clone NBRI_GE18496 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012460778.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-81DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D2TK880.0A0A0D2TK88_G
STRINGGLYMA02G42140.31e-112(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43402657
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05790.15e-93MYB family protein